# # robots.txt # User-agent: * Allow: *.js Allow: *.css Allow: /help/api/sitemap/google/ Disallow: */login?* Disallow: */popups/* Disallow: */pro-connect/b/* Disallow: */results.aspx?* Disallow: */retrieve?* Disallow: */searchresults.aspx* Disallow: */search.aspx?* Disallow: */search?q=* Disallow: */shared/jsoncontent/* Disallow: *?app=* Disallow: *?regionsite=* Disallow: /api/dpp/* Disallow: /api/package/* Disallow: *?checkAvail= Disallow: *?realm= Disallow: /role/ Disallow: /Shop/ Disallow: *?like= Disallow: /domain-auctions/* Disallow: /domainsearch/find* Disallow: /domain-value-appraisal/appraisal/?* Disallow: /dpp/find? Disallow: /domainsapi/ Disallow: /garage/advert/ Disallow: /garage/wp-admin/ Disallow: /garage/wp-content/plugins/ Disallow: /garage/wp-includes/ Disallow: /garage/readme.html Disallow: /blog/advert/ Disallow: /blog/wp-admin/ Disallow: /blog/wp-content/plugins/ Disallow: /blog/wp-includes/ Disallow: /blog/readme.html Disallow: /getstarted/* Disallow: /help/api/ Disallow: /help/website-templates/ Disallow: */homepages/* Disallow: */offers/* Disallow: /godaddy-404 Disallow: /configure$ Disallow: /market-demo/ Disallow: /pro-connect/b/ Disallow: /wordpress-themes/*-1* Disallow: /wordpress-themes/*-2* Disallow: /wordpress-themes/*-3* Disallow: /wordpress-themes/*-4* Disallow: /wordpress-themes/*-5* Disallow: /wordpress-themes/*-6* Disallow: /wordpress-themes/*-7* Disallow: /wordpress-themes/*-8* Disallow: /wordpress-themes/*-9* Disallow: /community/*/m-p/ Disallow: /community/*/rss/message Disallow: /community/*/removed-posts/ Disallow: /community/*/Removed-Posts/ Disallow: /community/*/recentpostspage/ Disallow: /community/tag/*/board-id/ Disallow: /community/*/tag-scope/ Disallow: /community/user/* Disallow: /community/groups/ Disallow: /community/badges/ Disallow: /community/kudos/* Disallow: /community/media/ Disallow: /community/notifications/ Disallow: /community/util/ Disallow: /community/tagging/ Disallow: /community/*/highlight/true Disallow: /community/search/discussions/ Disallow: /community/searchpage/* Disallow: /community/forums/v4/ Disallow: /community/forums/v5/ Disallow: /community/forums/postpage/ Disallow: /community/forums/editpage/ Disallow: /community/forums/forumtopicprintpage/ Disallow: /community/forums/filteredbylabelpage/ Disallow: /community/forums/tagdetailpage/ Disallow: /community/forums/replypage/board-id/ Disallow: /community/forums/recentpostspage.searchform.messagesearchfield/ Disallow: /community/forums/searchpage.searchauthorfilter/ Disallow: /community/forums/tagdetailpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent Disallow: /community/forums/unansweredtopicspage.disableautocomplete:disableautocomplete Disallow: /community/forums/v3_1/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent Disallow: /community/forums/v3_1/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform Disallow: /community/forums/v3_1/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform Disallow: /community/forums/v4/forumtopicpage.kudosbuttonv2.kudoentity:kudoentity/ Disallow: /community/forumtopicpage.kudosbuttonv2.kudoentity:kudoentity/message-uid/ Disallow: /community/forums/forumpage.disableautocomplete:disableautocomplete Disallow: /community/forums/forumpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent Disallow: /community/forums/forumpage.searchform/ Disallow: /community/forums/forumtopicpage.disableautocomplete:disableautocomplete Disallow: /community/forums/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent Disallow: /community/forums/forumtopicpage.lineardisplay/ Disallow: /community/forums/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform Disallow: /community/forums/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete Disallow: /community/forums/forumtopicpage.searchform.usersearchfield/ Disallow: /community/forums/forumtopicpage.searchform.usersearchfield:userexistsquery Disallow: /community/forums/forumtopicprintpage.kudosbuttonv2.kudoentity:kudoentity/ Disallow: /community/community/categorypage.childnodelisttaplet.boardlist_0.grid.columns:sort/ Disallow: /community/community/categorypage.disableautocomplete:disableautocomplete Disallow: /community/community/page.childnodelisttaplet.boardlist_0.grid.columns:sort/ Disallow: /community/community/page.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent Disallow: /whois/cards/business-card Disallow: /en/help/* Sitemap: https://my.godaddy.com/sitemap.xml Sitemap: https://my.godaddy.com/help/api/sitemap/google/